NSG2_MOUSE P47759
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47759
Recommended name：Neuronal vesicle trafficking-associated protein 2
EC number：
Alternative names：(Neuron-specific protein family member 2) (Protein 8.5) (Protein p19)
Cleaved into：
GeneID：18197
Gene names (primary )：Nsg2
Gene names (synonym )：
Gene names (ORF )：
Length：171
Mass：19000
Sequence：MVKLNSNPGEKGAKPPSVEDGFQTVPLITPLEVNHLQLAAPEKVIVKTRTEYQPEQRNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPSSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Tissue specificity：Specifically expressed in neural and neuroendocrine tissues. Pituitary and less in adrenal gland and testis. Expressed in the hippocampus throughout development. Remains enriched in layer V cortical neurons during development. At P0, broadly expressed in the neocortex. Is down-regulated overall at P8 and P14, but remains relatively enriched in layer V. At P0 is lower expressed in the cerebellum. Expression remains low throughout development, and is undetectable by adulthood (PubMed:28299779). {ECO:0000269|PubMed:28299779}.
Induction：
Developmental stage：Highly expressed at 20 dpc. At 17.5 dpc, highly expressed in the cortical plate and basal subventricular zone. {ECO:0000269|PubMed:28299779}.
Protein families：NSG family