RGS16_RAT P56700
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56700
Recommended name：Regulator of G-protein signaling 16
EC number：
Alternative names：Retinal-specific RGS (RGS-r) Retinally abundant regulator of G-protein signaling
Cleaved into：
GeneID：
Gene names (primary )：Rgs16
Gene names (synonym )：Rgsr
Gene names (ORF )：
Length：199
Mass：22,400
Sequence：MCRTIATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGNGKFEWASKLSKERSFSEDVLGWRESFQSLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSASGSSPAEPSHT
Tissue specificity：Predominantly found in the retina. Some expression has been found in the liver. 1
Induction：
Developmental stage：
Protein families：