VA0E1_RAT Q794C0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q794C0
Recommended name：V-type proton ATPase subunit e 1
EC number：
Alternative names：D-serine-regulated transcript 1 protein (DSR-1) V-ATPase 9.2 kDa membrane accessory protein V-ATPase M9.2 subunit Vacuolar proton pump subunit e 1
Cleaved into：
GeneID：94170
Gene names (primary )：Atp6v0e1
Gene names (synonym )：Atp6v0e, Dsr1
Gene names (ORF )：
Length：81
Mass：9,340
Sequence：MAYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP
Tissue specificity：
Induction：
Developmental stage：
Protein families：