PO4F3_RAT   D3ZTL1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZTL1

Recommended name:POU domain, class 4, transcription factor 3

EC number:

Alternative names:

Cleaved into:

GeneID:364855

Gene names  (primary ):Pou4f3

Gene names  (synonym ):

Gene names  (ORF ):

Length:338

Mass:37,043

Sequence:MMAMNAKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALTSHPHHPVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHAVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH

Tissue specificity:Expressed in the chochlea of the inner ear. 1

Induction:

Developmental stage:At 14 dpc, strongly expressed in cochlear and vestibular hair cells of the inner ear, in the cochlea at 18 dpc and coninues to the adulthood. 1

Protein families:


   💬 WhatsApp