SH3L2_HUMAN   Q9UJC5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UJC5

Recommended name:SH3 domain-binding glutamic acid-rich-like protein 2

EC number:

Alternative names:(Fovea-associated SH3 domain-binding protein)

Cleaved into:

GeneID:83699

Gene names  (primary ):SH3BGRL2

Gene names  (synonym ):FASH3

Gene names  (ORF ):

Length:107

Mass:12326

Sequence:MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP

Tissue specificity:Highly expressed in brain, placenta, liver and kidney. Expressed in retina. {ECO:0000269|PubMed:12095696}.

Induction:

Developmental stage:

Protein families:SH3BGR family


   💬 WhatsApp