EXAS1_HUMAN   Q8N2X6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N2X6

Recommended name:Uncharacterized protein EXOC3-AS1

EC number:

Alternative names:(EXOC3 antisense RNA 1) (EXOC3 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):EXOC3-AS1

Gene names  (synonym ):C5orf55

Gene names  (ORF ):

Length:119

Mass:12661

Sequence:MPAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPATSRQAALGTSWTQRRTQPLQERSHWHPRGNNASGMGGHRMFPGPLRGPAAQVLENECGSLGRAAEGRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp