CCL2_RAT P14844
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14844
Recommended name:C-C motif chemokine 2
EC number:
Alternative names:
Cleaved into:
GeneID:24770
Gene names (primary ):Ccl2
Gene names (synonym ):Je, Mcp1, Scya2
Gene names (ORF ):
Length:148
Mass:16,460
Sequence:MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Tissue specificity:In pancreatic islets, secretion is stimulated by IL1B (PubMed:23955712). In islets from Zucker diabetic fatty (ZDF) rats, but not lean animals, secretion is also increased by endocannabinoid anandamide/AEA (PubMed:23955712). 1
Induction:
Developmental stage:
Protein families: