KI2L4_HUMAN Q99706
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99706
Recommended name:Killer cell immunoglobulin-like receptor 2DL4
EC number:
Alternative names:(CD158 antigen-like family member D) (G9P) (Killer cell inhibitory receptor 103AS) (KIR-103AS) (MHC class I NK cell receptor KIR103AS) (CD antigen CD158d)
Cleaved into:
GeneID:3805
Gene names (primary ):KIR2DL4
Gene names (synonym ):CD158D KIR103AS
Gene names (ORF ):
Length:377
Mass:41487
Sequence:MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKDAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI
Tissue specificity:Expressed in decidual NK cells and innate lymphoid cell type I (ILC1) (PubMed:29262349). Expressed in a subset of peripheral NK cells (PubMed:19304799). {ECO:0000269|PubMed:19304799, ECO:0000269|PubMed:29262349}.
Induction:
Developmental stage:
Protein families:Immunoglobulin superfamily