HMNL_RAT C0HLU6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:C0HLU6
Recommended name：Humanin-like protein Curated
EC number：
Alternative names：Rattin 1 Publication
Cleaved into：
GeneID：
Gene names (primary )：UP000002494
Gene names (synonym )：Mitochondrion
Gene names (ORF )：
Length：38
Mass：4,338
Sequence：MAKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY
Tissue specificity：In the testis, expressed in Leydig cells at 10, 20 and 60 days of age (at protein level) (PubMed:16619233). Also expressed in pachytene spermatocytes at day 20 and in vessels, peritubular cells and spermatids at day 60 (PubMed:16619233). Not detected in Sertoli cells (at protein level) (PubMed:16619233). In the adult ovary, expressed in stromal cells, granulosa cells, theca cells and oocytes at diestrus and proestrus (at protein level) (PubMed:33764899). Expressed in the anterior pituitary where it is detected in lactotropes and somatotropes with lower levels in females than males (at protein level) (PubMed:25360890). In the hippocampus, expressed in astrocytes but not in neurons or oligodendrocytes (at protein level) (PubMed:31214013). Expressed in muscle, liver and hypothalamus but not in epididymal fat (at protein level) (PubMed:19623253). Widely expressed with highest levels in cardiac and skeletal muscle and lowest levels in lung, testis and uterus (PubMed:12154011). In the CNS, levels are relatively high in the cerebellum and cortex and low in the hippocampus (PubMed:12154011). In the hippocampus, lower levels are detected in ovariectomized animals than in controls (PubMed:31214013). 6 s
Induction：Levels decline with increasing age. 1 Publication
Developmental stage：Repressed by estrogen in anterior pituitary cells (PubMed:25360890). Induced by estrogen and progesterone in astrocytes (PubMed:31214013). Induced by growth hormone and Igf1 in Leydig cells at 10 and 40 days old but not at 60 days (PubMed:16619233). 3 s
Protein families：