GLCM1_RAT Q04807
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q04807
Recommended name:Glycosylation-dependent cell adhesion molecule 1
EC number:
Alternative names:Endothelial ligand FOR L-selectin SGP50 Sulfated 50 kDa glycoprotein
Cleaved into:
GeneID:25258
Gene names (primary ):Glycam1
Gene names (synonym ):
Gene names (ORF ):
Length:146
Mass:15,440
Sequence:MKFFTVLLFASLAATSLAAVPGSKDELHLRTQPTDAIPASQFTPSSHISKESTSSKDLSKESFIFNEELVSEDNVGTESTKPQSQEAQDGLRSGSSQQEETTSAATSEGKLTMLSQAVQKELGKVIEGFISGVEDIISGASGTVRP
Tissue specificity:Lymph nodes. Associated with the lumenal surface of the high endothelial venules of peripheral lymph nodes.
Induction:
Developmental stage:
Protein families: