ANFB_RAT P13205
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13205
Recommended name：Natriuretic peptides B
EC number：
Alternative names：Brain natriuretic peptide 45 1 Publication (BNP-45 1 Publication) Alternative names: 5 kDa cardiac natriuretic peptide 1 Publication, Brain natriuretic peptide 1 Publication (BNP 1 Publication)
Cleaved into：
GeneID：25105
Gene names (primary )：Nppb
Gene names (synonym )：
Gene names (ORF )：
Length：121
Mass：13,656
Sequence：MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Tissue specificity：Expressed in the atria and ventricles, but at much lower levels than NPPA (PubMed:1837590). Expression levels in the ventricles are slightly higher than in the atria (PubMed:1837590). Very low levels of expression detected in the brain, hypothalamus, lung and aorta (PubMed:1837590). 1
Induction：Up-regulated in cardiocytes in response to stretching for 48hr (PubMed:9252368). Induced by lipopolysaccharides (PubMed:30980393). 2 Publications
Developmental stage：Atria (at protein level) (PubMed:2673236). Cardiocytes (at protein level) (PubMed:9252368). 2 s
Protein families：