RGN_MOUSE Q64374
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64374
Recommended name：Regucalcin
EC number：EC 3.1.1.17
Alternative names：(RC) (Gluconolactonase) (GNL) (Senescence marker protein 30) (SMP-30)
Cleaved into：
GeneID：19733
Gene names (primary )：Rgn
Gene names (synonym )：Smp30
Gene names (ORF )：
Length：299
Mass：33407
Sequence：MSSIKVECVLRENYRCGESPVWEEASQSLLFVDIPSKIICRWDTVSNQVQRVAVDAPVSSVALRQLGGYVATIGTKFCALNWENQSVFVLAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLQTGQISNRRIVYKMEKDEQIPDGMCIDAEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGLNAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
Tissue specificity：Mainly present in the liver. Weak expression was found in the brain, lung and kidney. {ECO:0000269|PubMed:8765750, ECO:0000269|PubMed:9278263}.
Induction：By calcium. {ECO:0000269|PubMed:9278263}.
Developmental stage：Protein amounts in liver decrease significantly with age.
Protein families：SMP-30/CGR1 family