DHB12_RAT Q6P7R8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P7R8
Recommended name：Very-long-chain 3-oxoacyl-CoA reductase Curated
EC number：EC:1.1.1.330
Alternative names：17-beta-hydroxysteroid dehydrogenase 12 By Similarity (17-beta-HSD 12 By Similarity) 3-ketoacyl-CoA reductase By Similarity (KAR By Similarity) Estradiol 17-beta-dehydrogenase 12 By Similarity (EC:1.1.1.62 By Similarity) . EC:1.1.1.62 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：84013
Gene names (primary )：Hsd17b12
Gene names (synonym )：
Gene names (ORF )：
Length：312
Mass：34,841
Sequence：MERALPAAGFLYWVGASTIAYLTLRASYSLFRAFQVWCVGNQAFVGPRLGEWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSICKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLAKIRKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHAIMGSINSILPRWIYFKTIMGFNKSLRNRYLKKTKKN
Tissue specificity：
Induction：
Developmental stage：
Protein families：short-chain dehydrogenases/reductases (SDR) family