DDT4L_MOUSE   Q8VHZ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VHZ5

Recommended name:DNA damage-inducible transcript 4-like protein

EC number:

Alternative names:(HIF-1 responsive protein RTP801-like) (Soleus muscle atrophied after hindlimb suspension protein 1)

Cleaved into:

GeneID:73284

Gene names  (primary ):Ddit4l

Gene names  (synonym ):Rtp801l Smhs1

Gene names  (ORF ):

Length:193

Mass:21581

Sequence:MVATGSLSSKNPASISELLDGGYHPGSLLSDFDYWDYVVPEPNLNEVVFEETTCQNLVKMLENCLSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSGLKRTLILSSGFRLVKKKLYSLIGTTVIEEC

Tissue specificity:

Induction:

Developmental stage:

Protein families:DDIT4 family