FOXI2_MOUSE Q3I5G5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3I5G5
Recommended name：Forkhead box protein I2
EC number：
Alternative names：
Cleaved into：
GeneID：270004
Gene names (primary )：Foxi2
Gene names (synonym )：
Gene names (ORF )：
Length：311
Mass：32784
Sequence：MAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNSAALSPAPYATGPGPAPSYAAATLAVPGSLLGASGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSEATTTCLSGFSTAMGALAGGFGALPDGLAHDFSLRRPPPTAAAHSPQIPNTAPGFAPGHQTGATGFRMGHLIYSRDGTEV
Tissue specificity：
Induction：
Developmental stage：Expressed in a subset of cells of the olfactory epithelium, in the dental epithelium, in developing whiskers and in cells lining the endolymphatic duct of the inner ear at stage 16.5 dpc. Also expressed in kidney, hair follicles, thymus and in collecting ducts from the mandibular gland as well as in a subset of epithelial cells lining the sublingual and submaxillary ducts from the salivary glands to the oral cavity at stage 18.5 dpc. Expressed in the developing brain along a neuromeric boundary between prosomeres p5 and p6 as well as in the neural layer of the retina. {ECO:0000269|PubMed:16289364}.
Protein families：