SELK_HUMAN Q9Y6D0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y6D0
Recommended name：Selenoprotein K
EC number：
Alternative names：(SelK)
Cleaved into：
GeneID：58515
Gene names (primary )：SELENOK
Gene names (synonym )：SELK
Gene names (ORF )：HSPC030 HSPC297
Length：94
Mass：10645
Sequence：MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR
Tissue specificity：Highly expressed in heart. {ECO:0000269|PubMed:16962588}.
Induction：By ER stress (at protein level). Displays a slow increase with a lag phase of 6 hours but exhibits a dramatic increase after incubation with ER stress agents for more than 12 hours with maximum induction at 24 hours. Also induced by accumulation of misfolded proteins in the ER. {ECO:0000269|PubMed:20692228, ECO:0000269|PubMed:22016385}.
Developmental stage：
Protein families：Selenoprotein K family