ATG4A_HUMAN   Q8WYN0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WYN0

Recommended name:Cysteine protease ATG4A

EC number:EC:3.4.22.-

Alternative names:(AUT-like 2 cysteine endopeptidase) (Autophagin-2) (Autophagy-related cysteine endopeptidase 2) (Autophagy-related protein 4 homolog A) (hAPG4A)

Cleaved into:

GeneID:115201

Gene names  (primary ):ATG4A

Gene names  (synonym ):APG4A AUTL2

Gene names  (ORF ):

Length:398

Mass:45378

Sequence:MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV

Tissue specificity:Widely expressed, at a low level, and the highest expression is observed in skeletal muscle and brain. Also detected in fetal liver. {ECO:0000269|PubMed:12446702, ECO:0000269|PubMed:15169837}.

Induction:

Developmental stage:

Protein families:Peptidase C54 family


   💬 WhatsApp