ROB1_RAT O55006
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55006
Recommended name：Protein RoBo-1
EC number：
Alternative names：
Cleaved into：
GeneID：24906
Gene names (primary )：UP000002494
Gene names (synonym )：Chromosome 10
Gene names (ORF )：
Length：240
Mass：26,187
Sequence：MSWFLVLKCLLTVCIISHLSVSSTESYGCIRKTCFGGRCLHNTTRSCEFSKGCFSQLQEFAVPLLLLNRRVEQRGCSEDNCTELAFSATLGIDWMFSYNHQCCYSEQCNNKPINVSPLSLQPNGVECPTCYSELGTCRPVSLKCTGAQTTCVNVTGQGIREDFIKIHAMGCATQTACNLKNVIILNNIKIDTSCVSGSPPLRYSPSLSTDQKTSSATAPTLCLLAAVLPAIMVMESFSEL
Tissue specificity：Expressed abundantly in bone, including the lengthening growth plate where cartilage is remodeled into bone. 1
Induction：
Developmental stage：Up-regulated by estradiol. 1
Protein families：