ZN706_MOUSE Q9D115
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D115
Recommended name：Zinc finger protein 706
EC number：
Alternative names：
Cleaved into：
GeneID：68036
Gene names (primary )：Znf706
Gene names (synonym )：Zfp706
Gene names (ORF )：
Length：76
Mass：8498
Sequence：MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
Tissue specificity：
Induction：
Developmental stage：Present in self-renewing embryonic stem cells (ESCs). Does not increase significantly at the onset of differentiation. {ECO:0000269|PubMed:24412312}.
Protein families：