TSN4_MOUSE   Q9DCK3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCK3

Recommended name:Tetraspanin-4

EC number:

Alternative names:(Tspan-4) (Transmembrane 4 superfamily member 7)

Cleaved into:

GeneID:64540

Gene names  (primary ):Tspan4

Gene names  (synonym ):Tm4sf7

Gene names  (ORF ):

Length:238

Mass:26054

Sequence:MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tetraspanin (TM4SF) family


   💬 WhatsApp