NACHO_RAT Q6JAM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6JAM9
Recommended name：Novel acetylcholine receptor chaperone 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：308134
Gene names (primary )：Tmem35a
Gene names (synonym )：Nacho 1 Publication, Tmem35, Tuf1 1 Publication
Gene names (ORF )：
Length：167
Mass：18,473
Sequence：MASPRTITIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSSEKKALPESAEEQPSLYEKAPQGKVKVS
Tissue specificity：Present in adrenal zona glomerusa but not in adrenal medulla (at protein level) (PubMed:20685870). Expressed in the hippocampus (at protein level) (PubMed:26875622). 2 s
Induction：Levels decrease during early postnatal development after which it remains stable into adulthood and this decrease occurs to a greater degree in the frontal cortex compared to the hippocampus (at protein level). 1 Publication
Developmental stage：By sodium depletion and angiotensin II in adrenal zona glomerusa (at protein level). 1
Protein families：