EIF3J_RAT A0JPM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A0JPM9
Recommended name：Eukaryotic translation initiation factor 3 subunit J UniRule Annotation
EC number：
Alternative names：Eukaryotic translation initiation factor 3 subunit 1 UniRule Annotation eIF-3-alpha UniRule Annotation eIF3 p35 UniRule Annotation
Cleaved into：
GeneID：691947
Gene names (primary )：Eif3j
Gene names (synonym )：Eif3s1
Gene names (ORF )：
Length：259
Mass：29,187
Sequence：MAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Tissue specificity：
Induction：
Developmental stage：
Protein families：