WFDC6_HUMAN   Q9BQY6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BQY6

Recommended name:WAP four-disulfide core domain protein 6

EC number:

Alternative names:(Putative protease inhibitor WAP6)

Cleaved into:

GeneID:140870

Gene names  (primary ):WFDC6

Gene names  (synonym ):C20orf171 WAP6

Gene names  (ORF ):

Length:131

Mass:14626

Sequence:MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKIYAVCHRRLAPAWPPYHTGGTIKKTKICSEFIYGGSQGNNNNFQTEAICLVTCKKYH

Tissue specificity:Ubiquitously expressed, but the highest levels are found in epididymis, testis and trachea.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp