ZIC4_MOUSE Q61467
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61467
Recommended name：Zinc finger protein ZIC 4
EC number：
Alternative names：(Zinc finger protein of the cerebellum 4)
Cleaved into：
GeneID：22774
Gene names (primary )：Zic4
Gene names (synonym )：
Gene names (ORF )：
Length：341
Mass：37437
Sequence：MRLGRVCPRGPGKVRSPRHRFSCTLFVSTTGSSCGHHGPQLAASSNPSVLPGLHEQPPQASHSRPLNGLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLTMNLTAPHGPGAFFRYMRQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSAITSALASPSLESGREPSVACSAAVVVRGTDVSE
Tissue specificity：Exclusively expressed in the cerebellum. {ECO:0000269|PubMed:8682319}.
Induction：
Developmental stage：First expressed in embryo at 9 dpc. Expressed in the dorsal midline of the forebrain at 10.5 dpc at the boundary between the diencephalon and telencephalon, the septum, and the lamina terminalis. Expressed in the choroid plexus of the third ventricle, the dorsal part of the spinal neural tube, the dorsal sclerotome and the dorsomedial lip of the dermomyotome between 10.5 and 12.5 dpc. Expressed in the midline of the forebrain and in the dorsal spinal neural tube at 12.5 dpc. {ECO:0000269|PubMed:15895369, ECO:0000269|PubMed:8682319}.
Protein families：GLI C2H2-type zinc-finger protein family