OPN3_MOUSE Q9WUK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUK7
Recommended name:Opsin-3
EC number:
Alternative names:(Encephalopsin) (Panopsin)
Cleaved into:
GeneID:13603
Gene names (primary ):Opn3
Gene names (synonym ):Ecpn
Gene names (ORF ):
Length:400
Mass:44947
Sequence:MYSGNRSGDQGYWEDGAGAEGAAPAGTRSPAPLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTFTFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDIHGLGCTVDWRSKDANDSSFVLFLFLGCLVVPVGIIAHCYGHILYSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYIVTRFLVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMNRKFRRSLLQLLCFRLLRCQRPAKNLPAAESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSSASKVDVIQVRPL
Tissue specificity:Expressed in the eye (at protein level) (PubMed:30284927). Expressed in tracheal airway smooth muscle (PubMed:30284927). Expressed in brown adipocyte tissue; expression becomes more abundant during differentiation (PubMed:32040503). Strongly expressed in brain (PubMed:10234000). Highly expressed in the preoptic area and paraventricular nucleus of the hypothalamus (PubMed:10234000). Shows highly patterned expression in other regions of the brain, being enriched in selected regions of the cerebral cortex, cerebellar Purkinje cells, a subset of striatal neurons, selected thalamic nuclei, and a subset of interneurons in the ventral horn of the spinal cord (PubMed:10234000). {ECO:0000269|PubMed:10234000, ECO:0000269|PubMed:30284927, ECO:0000269|PubMed:32040503}.
Induction:
Developmental stage:Expressed at substantial levels in the dorsal pons at 18.5 dpc (PubMed:10234000). Expressed in Purkinje cells at P4, with expression becoming striped at P20 (PubMed:10234000). Expressed in the cerebral cortex from 18.5 dpc with a rostrocaudal gradient of expression becoming evident at P20 (PubMed:10234000). {ECO:0000269|PubMed:10234000}.
Protein families:G-protein coupled receptor 1 family, Opsin subfamily