APEL_HUMAN Q9ULZ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ULZ1
Recommended name：Apelin
EC number：
Alternative names：(APJ endogenous ligand)
Cleaved into：Apelin-36; Apelin-31; Apelin-28; Apelin-13
GeneID：8862
Gene names (primary )：APLN
Gene names (synonym )：APEL
Gene names (ORF )：
Length：77
Mass：8569
Sequence：MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Tissue specificity：Expressed in the brain with highest levels in the frontal cortex, thalamus, hypothalamus and midbrain (PubMed:10617103). Secreted by the mammary gland into the colostrum and the milk. {ECO:0000269|PubMed:10617103}.
Induction：
Developmental stage：
Protein families：Apelin family