XAGE1_HUMAN Q9HD64
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HD64
Recommended name：X antigen family member 1
EC number：
Alternative names：(XAGE-1) (Cancer/testis antigen 12.1) (CT12.1) (G antigen family D member 2)
Cleaved into：
GeneID：653067
Gene names (primary )：XAGE1A; XAGE1B
Gene names (synonym )：GAGED2 XAGE1; XAGE1C XAGE1D XAGE1E
Gene names (ORF )：;
Length：81
Mass：9078
Sequence：MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV
Tissue specificity：In normal tissues, highly expressed in testis. Expressed also in many different types of cancers: highly expressed in breast cancer, prostate cancer and many types of lung cancers, including squamous cell carcinoma, small cell carcinoma, non-small cell carcinoma, and adenocarcinoma, as well as in Ewing's cell lines, in some Ewing's sarcoma patient samples, and in one of one alveolar rhabdomyosarcoma patient sample. {ECO:0000269|PubMed:12479262, ECO:0000269|PubMed:17335148}.
Induction：
Developmental stage：
Protein families：GAGE family