SIA7C_HUMAN   Q8NDV1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NDV1

Recommended name:Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3

EC number:EC:2.4.99.7

Alternative names:(GalNAc alpha-2,6-sialyltransferase III) (ST6GalNAc III) (ST6GalNAcIII) (STY) (Sialyltransferase 7C) (SIAT7-C)

Cleaved into:

GeneID:256435

Gene names  (primary ):ST6GALNAC3

Gene names  (synonym ):SIAT7C

Gene names  (ORF ):UNQ2787/PRO7177

Length:305

Mass:35395

Sequence:MACILKRKSVIAVSFIAAFLFLLVVRLVNEVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDLCAIVSNSGQMVGQKVGNEIDRSSCIWRMNNAPTKGYEEDVGRMTMIRVVSHTSVPLLLKNPDYFFKEANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGSYLSTGWFTFLLAMDACYGIHVYGMINDTYCKTEGYRKVPYHYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWTLS

Tissue specificity:Expressed in brain and kidney (PubMed:16169874, PubMed:17123352). Observed in the epithelium of the proximal tubules, marginal expression was also found in the distal tubules and collecting tubules (PubMed:17123352). {ECO:0000269|PubMed:16169874, ECO:0000269|PubMed:17123352}.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 29 family


   💬 WhatsApp