SNR27_MOUSE   Q8K194


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K194

Recommended name:U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

EC number:

Alternative names:(U4/U6.U5 snRNP 27 kDa protein) (U4/U6.U5-27K) (U4/U6.U5 tri-snRNP-associated protein 3)

Cleaved into:

GeneID:66618

Gene names  (primary ):Snrnp27

Gene names  (synonym ):

Gene names  (ORF ):

Length:155

Mass:18885

Sequence:MGRSRSRSPRRERRRSRSTSRDRERRRRERSRSRERDRRRSRSRSPHRRRSRSPRRHRSTSPSPSRLKERRDEEKKETKEIKNKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA

Tissue specificity:

Induction:

Developmental stage:

Protein families:SNUT3 family


   💬 WhatsApp