S2534_MOUSE   A2ADF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2ADF7

Recommended name:Solute carrier family 25 member 34

EC number:

Alternative names:

Cleaved into:

GeneID:384071

Gene names  (primary ):Slc25a34

Gene names  (synonym ):Gm1369

Gene names  (ORF ):

Length:318

Mass:33778

Sequence:MKPTQAQMAPAMDSREMVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTYPRPYRGFVSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAAAGALGAFVGSPAYLVKTQLQAQTVATMAVGHQHQHQGVLSALETIWRQQGMLGLWRGVGGAVPRVTVGSAAQLATFTSAKAWVQDRQWFLEDSWLVTLAGGMISSIAVVAVMTPLDVVSTRLYNQPVDRAGRGQLYGGLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSMFFWDELRKLVARAQHQGT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp