PDGFC_MOUSE Q8CI19
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CI19
Recommended name：Platelet-derived growth factor C
EC number：
Alternative names：(PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E)
Cleaved into：Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)
GeneID：54635
Gene names (primary )：Pdgfc
Gene names (synonym )：Scdgf
Gene names (ORF )：
Length：345
Mass：38741
Sequence：MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
Tissue specificity：Mainly expressed in kidney, testis, liver, heart and brain (at protein level). Highly expressed in airway epithelium, interstitial cells and alveolar macrophages in the lung of mice overexpressing IL13. Expressed in the ovaries. {ECO:0000269|PubMed:11297552, ECO:0000269|PubMed:11744381, ECO:0000269|PubMed:16344272, ECO:0000269|PubMed:16951379, ECO:0000269|PubMed:18184860}.
Induction：Expression decreased by hypoxia. Up-regulated by EWS-FLI1 transcription factor in tumor-derived cells. Up-regulated by IL13 overexpression in the lung via STAT6 and EGR1. Elevated expression induced by coxsackievirus B3 infection in immunodeficient mice. Overexpressed in the renal fibrosis. Expression in the lung is significantly increased after bleomycin treatment. Down-regulated by retinoic acid and gonadotropin. {ECO:0000269|PubMed:11313995, ECO:0000269|PubMed:12972405, ECO:0000269|PubMed:15757957, ECO:0000269|PubMed:15911618, ECO:0000269|PubMed:16344272, ECO:0000269|PubMed:16951379, ECO:0000269|PubMed:17066417}.
Developmental stage：In stage 9.5 dpc-15.5 dpc, widely expressed in the surface ectoderm and later in the germinal layer of the skin, the olfactory and otic placode and their derivatives and the lining of the oral cavity. In stages 14.5 dpc-17.5 expressed in ducts connected to epidermis, and in developing epidermal openings. Highly expressed in the early stages of the developing kidney, in the metanephric mesenchymal aggregates, prefusion skeletal muscle, cardiac myoblasts, and in visceral and vascular smooth muscle. {ECO:0000269|PubMed:10806482, ECO:0000269|PubMed:10960785, ECO:0000269|PubMed:15061151, ECO:0000269|PubMed:15372073}.
Protein families：PDGF/VEGF growth factor family