F234B_MOUSE   Q8BYI8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BYI8

Recommended name:Protein FAM234B

EC number:

Alternative names:

Cleaved into:

GeneID:74525

Gene names  (primary ):Fam234b

Gene names  (synonym ):Kiaa1467

Gene names  (ORF ):

Length:624

Mass:67031

Sequence:MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGKSALGDLPEPDSDADVAGAAKPHLSEVTPEGFPSEPLGGLEQKATSPLVSYVRTSVFLLTLVISMVLVLLCAFLIPCPPRDLHSAWSRRLGSQGGGDLSPLELADVNRDGLRDVLLTFVTTRNGTEGGVGSQPTADLVCLSGMNGSTLWSSPLPEEAQDVTCLDLIPGSVAKTICLVTGTRKMLSAFNATSGKVLWTLNPNHLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGSPVGRPVKYNIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQIEEPEWEKHRSVNLSELIDVYSDGVELLQLVKAPDSNSSSLLITTRQGLVLLRGQDLTPHWKLNLQGLRSQPTPGYFTDDQTLDFLLQTQDGDGMKKMTVVDGGSGSIVWSYSIPCHMKETPTTSAITSDQKSVFLFWAEALTAASLSSDDSSGAEPPGLYHLYLLHPAFPSILLDLSNTTGIVTASEVGINDIWKDAFYVTRTTGMSPEGHPTSLVVSKLSLRWALMEGQMVQLKETTPKIGRGELRRFLSRIKFVDSPYQI

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM234 family


   💬 WhatsApp