B9D1_MOUSE Q9R1S0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1S0
Recommended name：B9 domain-containing protein 1
EC number：
Alternative names：(Endothelial precursor cells protein B9)
Cleaved into：
GeneID：27078
Gene names (primary )：B9d1
Gene names (synonym )：Eppb9
Gene names (ORF )：
Length：204
Mass：22592
Sequence：MAAASPSVFLLMITGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYDTGPVDTQGVLGPSLPQGNPQ
Tissue specificity：
Induction：
Developmental stage：Specifically or prominently expressed in mouse blastocysts compared to 4-cell stage embryos. {ECO:0000269|PubMed:15625703}.
Protein families：B9D family