D104A_HUMAN Q8WTQ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WTQ1
Recommended name：Beta-defensin 104
EC number：
Alternative names：(Beta-defensin 4) (BD-4) (DEFB-4) (hBD-4) (Defensin, beta 104)
Cleaved into：
GeneID：140596
Gene names (primary )：DEFB104A; DEFB104B
Gene names (synonym )：DEFB104 DEFB4;
Gene names (ORF )：;
Length：72
Mass：8526
Sequence：MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Tissue specificity：High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested. {ECO:0000269|PubMed:11481241}.
Induction：Antimicrobial activity is decreased when the sodium chloride concentration is increased.
Developmental stage：
Protein families：Beta-defensin family