HMGN2_HUMAN   P05204


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P05204

Recommended name:Non-histone chromosomal protein HMG-17

EC number:

Alternative names:(High mobility group nucleosome-binding domain-containing protein 2)

Cleaved into:

GeneID:3151

Gene names  (primary ):HMGN2

Gene names  (synonym ):HMG17

Gene names  (ORF ):

Length:90

Mass:9393

Sequence:MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Tissue specificity:

Induction:

Developmental stage:

Protein families:HMGN family


   💬 WhatsApp