DRD2_RAT P61169
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61169
Recommended name:D(2) dopamine receptor
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Drd2
Gene names (synonym ):
Gene names (ORF ):
Length:444
Mass:50,904
Sequence:MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC
Tissue specificity:Expressed in the anterior lobe of the pituitary gland (PubMed:2531656). Expressed ventral tegmental area of the midbrain and the pars compacta of the substantia nigra (PubMed:2531656). Expressed seven times more than isoform short in the caudate nucleus (PubMed:2137198). 2 s
Induction:
Developmental stage:Expressed in the anterior lobe of the pituitary gland (PubMed:2531656). Expressed in the caudate nucleus (PubMed:2137198). Not expressed in the wider brain (PubMed:2531656). 2 s
Protein families: