ISK13_RAT D3ZVP0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D3ZVP0
Recommended name：Serine protease inhibitor Kazal-type 13
EC number：
Alternative names：
Cleaved into：
GeneID：689570
Gene names (primary )：Spink13
Gene names (synonym )：
Gene names (ORF )：
Length：97
Mass：11,415
Sequence：MTRRGCWPHRIIFSLILLTWTHVTLAALIRSHTFSNWPKPPCKMYYPIDPDYEANCPDVIALVCATNGLNYKNECFFCIDRWEFGPHIEFVKYGKCE
Tissue specificity：Restricted to the epididymis, with highest levels in the initial segment, including epithelial cells, lumen, and sperm (at protein level). Localizes to the sperm heads, where it is restricted to the acrosomal region in epididymal spermatozoa, but not in testicular spermatozoa (at protein level). 1
Induction：First expressed at low levels at P15 in the epididymis. Expression increases from P30 onward. Reaches its highest level at P120 and remains at a stable level in mature animals. 1 Publication
Developmental stage：Up-regulated by testosterone. 1
Protein families：