FANK1_MOUSE Q9DAM9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAM9
Recommended name：Fibronectin type 3 and ankyrin repeat domains 1 protein
EC number：
Alternative names：(Germ cell-specific gene 1 protein) (GSG1)
Cleaved into：
GeneID：66930
Gene names (primary )：Fank1
Gene names (synonym )：
Gene names (ORF )：
Length：344
Mass：38260
Sequence：MEPHKVVPLSKPHPPVVGKVTHHSIELYWDLEQKEKRQGPQEQWLRFSIEEEDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTREPISSEHFHRAVSVNDEDLLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWEARDLGGCTALHWAADGGHCSVIDWMIKDGCEVDVVDTGSGWTPLMRVSAVTGSQKVASLLIEAGADVNIKDKDGKTPLMVAVLNNHEQLVQLLLDKGADATVKNEFGKGVLEMARVFDRQNVLSLLEEKKKKMPRKSSVH
Tissue specificity：Mostly restricted to testis (at protein level), including mid to late pachytene spermatocytes (stages VI-X), diplotene spermatocytes (stage XI), meiotically dividing spermatocytes (stage XII) and spermatids in steps 1-14. Highest levels in late pachytene spermatocytes and spermatids in steps 1-9. {ECO:0000269|PubMed:17604233}.
Induction：Expression is activated by FOXJ1. {ECO:0000269|PubMed:27914912}.
Developmental stage：In the developing testis, first detected at postnatal day 14 (P14) and levels increase after P20 (at protein level). At P20, detected in pachytene spermatocytes and round spermatids, but not in preleptotene and leptotene spermatocytes. Not detected in testis at P10. Detected in germinal vesicle (GV) stage oocytes and in embryos up to the 2-cell stage, but not in morula or blastocysts. {ECO:0000269|PubMed:15803458, ECO:0000269|PubMed:17604233}.
Protein families：