NENF_HUMAN Q9UMX5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UMX5
Recommended name：Neudesin
EC number：
Alternative names：(Cell immortalization-related protein 2) (Neuron-derived neurotrophic factor) (Protein GIG47) (Secreted protein of unknown function) (SPUF protein)
Cleaved into：
GeneID：29937
Gene names (primary )：NENF
Gene names (synonym )：CIR2 SPUF
Gene names (ORF )：
Length：172
Mass：18856
Sequence：MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
Tissue specificity：Ubiquitously expressed with high expression in heart. Over-expressed in various tumors including carcinomas of the uterine cervix, lymphoma, colon, lung, skin and leukemia, as well as carcinoma of the breast. {ECO:0000269|PubMed:22748190}.
Induction：Up-regulated in immortal cells. Induced in estrogen receptor positive breast cancer expressing progesterone receptor. {ECO:0000269|PubMed:16645950, ECO:0000269|PubMed:9771976}.
Developmental stage：
Protein families：Cytochrome b5 family, MAPR subfamily