HLPDA_HUMAN Q9Y5L2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y5L2
Recommended name:Hypoxia-inducible lipid droplet-associated protein
EC number:
Alternative names:(Hypoxia-inducible gene 2 protein)
Cleaved into:
GeneID:29923
Gene names (primary ):HILPDA
Gene names (synonym ):C7orf68 HIG2
Gene names (ORF ):
Length:63
Mass:6950
Sequence:MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Tissue specificity:Highly expressed in renal cell carcinoma cells but barely detectable in adjacent normal kidney tissue. Detected in some cervical and endometrial cancers. Expression also detected in fetal kidney with little or no expression observed in normal adult heart, liver, lung, pancreas, prostate or spinal cord (at protein level). {ECO:0000269|PubMed:15930302, ECO:0000269|PubMed:20624928, ECO:0000269|PubMed:21614900}.
Induction:By hypoxia but highly abundant under normoxic conditions (at protein level). {ECO:0000269|PubMed:10690527, ECO:0000269|PubMed:20624928}.
Developmental stage:
Protein families: