IEX1_MOUSE P46694
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P46694
Recommended name：Radiation-inducible immediate-early gene IEX-1
EC number：
Alternative names：(Immediate early protein GLY96) (Immediate early response 3 protein)
Cleaved into：
GeneID：15937
Gene names (primary )：Ier3
Gene names (synonym )：Gly96 Iex1
Gene names (ORF )：
Length：153
Mass：16875
Sequence：MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFL
Tissue specificity：Expressed predominantly in the lung, testes and the uterus.
Induction：By serum growth factors and TPA.
Developmental stage：
Protein families：IER3 family