T176A_MOUSE Q9DCS1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DCS1
Recommended name：Transmembrane protein 176A
EC number：
Alternative names：(Gene signature 188) (Kidney-expressed gene 2 protein)
Cleaved into：
GeneID：66058
Gene names (primary )：Tmem176a
Gene names (synonym )：Gs188 Keg2
Gene names (ORF )：
Length：244
Mass：26596
Sequence：MSTDMETAVVGKVDPEAPQPTHIDVHIHQESALAKLLLAGCSLLRIPASASTQSQGSSRVLVASWVVQTVLGALSVVLGGTLYIGHYLAMYSEGAPFWTGIVAMLAGAVAFLHKKRGGTCWALMRTLLVLASFCTAVAAIVIGSRELNFYWYFLGDDVCQRDSSYGWSTMPRTTPVPEEADRIALCIYYTSMLKTLLMSLQAMLLGIWVLLLLASLTPVCVYIWKRFFTKAETEEKKLLGAAVI
Tissue specificity：Specifically expressed in lung, kidney and spleen. {ECO:0000269|PubMed:11967007}.
Induction：Up-regulated in kidney upon proteinuria. {ECO:0000269|PubMed:11967007}.
Developmental stage：
Protein families：TMEM176 family