CCL5_HUMAN P13501
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13501
Recommended name：C-C motif chemokine 5
EC number：
Alternative names：(EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES)
Cleaved into：RANTES(3-68); RANTES(4-68)
GeneID：6352
Gene names (primary )：CCL5
Gene names (synonym )：D17S136E SCYA5
Gene names (ORF )：
Length：91
Mass：9990
Sequence：MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Tissue specificity：Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2456327}.
Induction：By mitogens.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family