KV2A4_MOUSE P01629
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01629
Recommended name:Ig kappa chain V-II region 2S1.3
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):
Gene names (synonym ):
Gene names (ORF ):
Length:112
Mass:12221
Sequence:DIVMTQAAFSNPVTLGTSASFSCRSSKSLQQSKGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGSGTDFTLRISRVEAEDVGVYYCANLQELPYTFGGGTKLEIK
Tissue specificity:
Induction:
Developmental stage:
Protein families: