DERM_MOUSE   Q9QZZ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZZ6

Recommended name:Dermatopontin

EC number:

Alternative names:(Early quiescence protein 1) (EQ-1) (Tyrosine-rich acidic matrix protein) (TRAMP)

Cleaved into:

GeneID:56429

Gene names  (primary ):Dpt

Gene names  (synonym ):

Gene names  (ORF ):

Length:201

Mass:23995

Sequence:MDLTLLWVLLPLVTTAWGQYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENV

Tissue specificity:

Induction:Induced by cell quiescence. {ECO:0000269|PubMed:14980498}.

Developmental stage:

Protein families:Dermatopontin family


   💬 WhatsApp