NAR2B_MOUSE   O35975


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35975

Recommended name:T-cell ecto-ADP-ribosyltransferase 2

EC number:EC 2.4.2.31

Alternative names:(ADP-ribosyltransferase C2 and C3 toxin-like 2) (ARTC2) (Mono(ADP-ribosyl)transferase 2B) (NAD(+) glycohydrolase) (T-cell NAD(P)(+)--arginine ADP-ribosyltransferase 2) (T-cell differentiation marker Rt6 homolog 2) (T-cell mono(ADP-ribosyl)transferase 2)

Cleaved into:

GeneID:11872

Gene names  (primary ):Art2b

Gene names  (synonym ):Rt6-2 Rt6.2

Gene names  (ORF ):

Length:289

Mass:33124

Sequence:MTSKIFKFFLTWWLTQQVTGLAVPFMLDMAPNAFDDQYESCVEDMEKKAPQLLQEDFNMNEELKLEWEKAEINWKEIKNSTSYPAGFHDFHGTALVAYTGNLAIDFNRAVRDFKKSPDNFHYKAFHYYLTRAVQLLNDQGCSLVYRGTKVMFEYTGKGSVRFGQFSSSSLTKRVALSSNFFSNHGTLFIIRTCLGVNIKEFSSFPREEEVLIPGYEVYHKVTAQNDNGYNEIFLDSPERKKSNFNCFYNGSAQTVNIDFSISGSRESCVSLFLVVLLGLLVQQLTLAEL

Tissue specificity:Expressed in spleen, intestine and thymus. {ECO:0000269|PubMed:9300695}.

Induction:

Developmental stage:

Protein families:Arg-specific ADP-ribosyltransferase family


   💬 WhatsApp