PTN_RAT   P63090


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63090

Recommended name:Pleiotrophin 1 Publication

EC number:

Alternative names:Heparin-binding brain mitogen 1 Publication (HBBM 1 Publication) Heparin-binding growth factor 8 By Similarity (HBGF-8 By Similarity) Heparin-binding growth-associated molecule 1 Publication (HB-GAM 1 Publication) Heparin-binding neutrophic factor 1 Publication (HBNF 1 Publication) Osteoblast-specific factor 1 By Similarity (OSF-1 By Similarity)

Cleaved into:

GeneID:24924

Gene names  (primary ):Ptn

Gene names  (synonym ):

Gene names  (ORF ):

Length:168

Mass:18,869

Sequence:MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Tissue specificity:Expressed in brain (PubMed:2170351). Hardly expressed in bone. Abundantly expressed in the growth plate. Intensely expressed in the cartilage matrix that forms the hollow for the secondary ossification center. Is expressed selectively by the osteocytes of the lamellar bone, whereas it is hardly expressed by those of the woven bone. Is detected in the matrix surrounding the osteocytes and in the canaliculi of the osteocytes. Is distributed on the surface of lamellar bone (PubMed:9817766). 2 s

Induction:

Developmental stage:Expressed at low levels in the brain in early embryonic stages. Levels increase to a maximum before or just after birth, and are lower in adult brain (PubMed:1768439). At 16 dpc intensely expressed in the matrix of the developing cartilage and persists in the matrix of the mineralized cartilage at 20 dpc (at protein level). Localized within the unmineralized cartilage matrix (at mRNA level) (PubMed:9817766). 2 s

Protein families:


   💬 WhatsApp