PIP30_MOUSE Q91WE2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WE2
Recommended name：PSME3-interacting protein
EC number：
Alternative names：(NEFA-interacting nuclear protein NIP30) (PA28G-interacting protein)
Cleaved into：
GeneID：102122
Gene names (primary )：Psme3ip1
Gene names (synonym )：Fam192a Nip30
Gene names (ORF )：
Length：254
Mass：28702
Sequence：MDGEDDSNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPKECPEEAYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELEELKEYRSNLNKVGISAENKEVEKKLAVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKAQEAPSCMSLGSSSLSGPPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP
Tissue specificity：Expressed in skeletal muscle. {ECO:0000269|PubMed:26497270}.
Induction：Up-regulated in response to denervation-induced skeletal muscle atrophy. Induced by MYOD1. {ECO:0000269|PubMed:26497270}.
Developmental stage：Shows relatively constant expression in both proliferating myoblasts and in differentiated myotubes, when assayed in C2C12 cell line (at protein level). {ECO:0000269|PubMed:26497270}.
Protein families：