RRAS2_HUMAN P62070
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62070
Recommended name：Ras-related protein R-Ras2
EC number：EC:3.6.5.-
Alternative names：(Ras-like protein TC21) (Teratocarcinoma oncogene)
Cleaved into：
GeneID：22800
Gene names (primary )：RRAS2
Gene names (synonym )：TC21
Gene names (ORF )：
Length：204
Mass：23400
Sequence：MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Tissue specificity：Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas. {ECO:0000269|PubMed:8052619}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Ras family