S19A3_MOUSE Q99PL8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99PL8
Recommended name：Thiamine transporter 2
EC number：
Alternative names：(ThTr-2) (ThTr2) (Solute carrier family 19 member 3)
Cleaved into：
GeneID：80721
Gene names (primary )：Slc19a3
Gene names (synonym )：
Gene names (ORF )：
Length：488
Mass：55073
Sequence：MDSSCRTPPSNSWVYPTVILCLFGFFSMFRPSEAFLIPFLSEPSKNLTSPEMTNEILPVWTYSYLATLPPVFVLTDYLRYKPVIMLHVVAFATSYLFLLFGQGVMLMQTAEFFFGVVSATEIAYFAYIYSMVSPEHYQKVSSYCRSITLVAYTAGSVLAQLLVSLTNLPYSSLFYISLACVSVAFFFSLFLPMPKKSMFFHAKSDRDDCPKPLEQCTVPKEAQSNRTHSELFANSKNLEDREMSNPDPENSALRHFAHWFQDLKECYSSKHLVYWSLWWAFATAGYNQILNYVQVLWEHKAPSQDSSIYNGAVEAIATFGGALASFSVGYLKVNWDLLGELGLAVFSAVIAGSLFLMNYSRSIWVCYAGYLLVKSSYSFLITIAVFQIAVNLSLERYALVFGIDTFIALVIQTIMTMIVVDQRGLQLPVTTQFLVYGSYFAVIAGVFLMRSIYILCSAKCRKEVQNLATTRSPNEPHPQEPSNVSTKF
Tissue specificity：High expression in kidney, brain, lung and small intestine.
Induction：
Developmental stage：
Protein families：Reduced folate carrier (RFC) transporter (TC 2.A.48) family